PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G109500.8
Common NameB456_007G109500, LOC105802809
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 638aa    MW: 71195.5 Da    PI: 6.7572
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G109500.8genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.97.8e-2375175198
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f k+lt sd++++g +++ +k+a+e+      ++ ++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   
  Gorai.007G109500.8  75 FSKILTASDTSTHGGFSVLRKHATEClppldmNLATP-TQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL-- 162
                         889***************************9744444.459************************************************.. PP

                         SSSEE..EEEEE- CS
                  B3  86 grsefelvvkvfr 98 
                         + +++el+v+v+r
  Gorai.007G109500.8 163 RGDNGELRVGVRR 175
                         3489999****98 PP

2Auxin_resp105.94.6e-35201280183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aaha++t++ F v+Y+Pr+  s+F++ v+k+++a+++ +svGmRfkm+fe+eds+err++Gt+vgv d++p +W++SkWrsLk
  Gorai.007G109500.8 201 AAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERRFTGTIVGVGDISP-HWSESKWRSLK 280
                         79****************6..9***********************************************99.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.75E-3960204IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.3E-4066190IPR015300DNA-binding pseudobarrel domain
CDDcd100171.18E-2073175No hitNo description
SMARTSM010199.3E-2275177IPR003340B3 DNA binding domain
PfamPF023629.0E-2175175IPR003340B3 DNA binding domain
PROSITE profilePS5086312.2875177IPR003340B3 DNA binding domain
PfamPF065072.7E-32201280IPR010525Auxin response factor
PfamPF023091.2E-7505559IPR033389AUX/IAA domain
SuperFamilySSF542771.57E-12521599No hitNo description
PROSITE profilePS5174526.629523615IPR000270PB1 domain
PfamPF023093.7E-6564611IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 638 aa     Download sequence    Send to blast
MEQLEASTNQ ELSNQTPLFN LPSKILCRVL HVELLAEQET DEVYAQITLQ PEDQSEPTSL  60
DPFPTEAPKR KVHSFSKILT ASDTSTHGGF SVLRKHATEC LPPLDMNLAT PTQELVAKDL  120
HGYEWRFKHI FRGQPRRHLL TTGWSTFVTS KRLVAGDAFV FLRGDNGELR VGVRRLARQQ  180
STMPSSVISS QSMHLGVLAT AAHAVTTHTL FVVYYKPRTS QFIIGVNKYL EAINNGFSVG  240
MRFKMRFEGE DSPERRFTGT IVGVGDISPH WSESKWRSLK IQWDEPAAIQ RPERVSPWEI  300
EPFVASASTN AQPTIMCKRP RPVDIPASEI TTSSAGSAFW CRESIQSHEL TPVGSTLEVQ  360
SSENQVMWPM RQKEADNCLI NGNGGYKSRT PPENAWPPSP LVNVSLNLFP DSMENNYKTG  420
ALQTALTGYA KGLMHDQVEK RKTETFTGCR LFGFNLTDST SVAAPPDKEQ TSTSIDYNGV  480
RGHVPAAFHV EQKPETSKEQ KQVASETSTQ EMQAKQGSAT SMRSRTKVHM QGIAVGRAID  540
LTALKGYNDL INELEKMFEI KGELCRSGQW SIVFTDDEGD MMLVGDDPWV EFCKMVRKIF  600
IYSSEEVKKI STRCKFPASS MECEGTVVSL DSEHRSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-150130349355Auxin response factor 1
4ldw_A1e-150130349355Auxin response factor 1
4ldw_B1e-150130349355Auxin response factor 1
4ldx_A1e-150130349355Auxin response factor 1
4ldx_B1e-150130349355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1317321KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ5670006e-40AJ567000.1 Gossypium hirsutum microsatellite DNA mGhCIR051, clone CIR051.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490133.10.0PREDICTED: auxin response factor 18-like isoform X3
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0D2TD410.0A0A0D2TD41_G
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]